PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0099329.1
Common NameNAM-A43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 54aa    MW: 6303.19 Da    PI: 4.8792
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0099329.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM621.8e-19753148
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                     lppGfrFhPtdeelv++yL+ k++g++++  +vike+d+yk++Pw+Lp
  Lj0g3v0099329.1  7 LPPGFRFHPTDEELVNHYLCTKCAGQSFNY-SVIKEIDLYKFDPWQLP 53
                     79**************************99.99**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-20354IPR003441NAC domain
PROSITE profilePS5100521.973754IPR003441NAC domain
PfamPF023659.8E-9850IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
MKGELELPPG FRFHPTDEEL VNHYLCTKCA GQSFNYSVIK EIDLYKFDPW QLPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-222531061Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.62026e-87cell culture| floral bud| protoplast| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3786395e-84AB378639.1 Lotus japonicus NAM-A43 mRNA for transcription factor NAC, complete cds.
GenBankBT1369925e-84BT136992.1 Lotus japonicus clone JCVI-FLLj-4N12 unknown mRNA.
GenBankBT1459925e-84BT145992.1 Lotus japonicus clone JCVI-FLLj-17M21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502989.18e-28PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390133e-23NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB3IX392e-32B3IX39_LOTJA; Transcription factor NAC
STRINGGLYMA04G38560.12e-26(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-24NAC family protein
Publications ? help Back to Top
  1. Asamizu E,Shimoda Y,Kouchi H,Tabata S,Sato S
    A positive regulatory role for LjERF1 in the nodulation process is revealed by systematic analysis of nodule-associated transcription factors of Lotus japonicus.
    Plant Physiol., 2008. 147(4): p. 2030-40
    [PMID:18567832]